PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC04G26200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 425aa    MW: 46079.9 Da    PI: 7.2427
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC04G26200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81e-32245299155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r+rWt++LHerFv++v+qLGG++kAtPk il+lm+ +gLt++h+kSHLQkYR+
  OPUNC04G26200.1 245 KTRIRWTQDLHERFVDCVNQLGGADKATPKGILKLMNSDGLTIYHIKSHLQKYRI 299
                      68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.662242302IPR017930Myb domain
SuperFamilySSF466898.78E-18243299IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-30244300IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-24245300IPR006447Myb domain, plants
PfamPF002497.8E-9249298IPR001005SANT/Myb domain
PfamPF143797.5E-18330374IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MNTKKIKLHD CHFGSPLCDP SPSPHLLSSA AAAAGLSFHP GLVSSAAQQQ HGAGGWLHED  60
YAPRSSPPLS LLAQTCVGSN ATAFYAAENL PQFDFPALGT TAAALAAMPT AAKTPFRSSE  120
SDLYRPVDPL LLRSDHSVRT YYVRPQKRDA GERTPLPPPS QQQHQDNILH GLFGGAPTTR  180
LLSGEPKIHS FSPQVAAKPI LPVMEAPSLQ NQIENQLSRS CIGAATPVTP TGNLAGSAGA  240
GAPSKTRIRW TQDLHERFVD CVNQLGGADK ATPKGILKLM NSDGLTIYHI KSHLQKYRIA  300
KYMPASSEGK QQEKRATGND MQNLDPKTGM QITEALRVQL DVQRRLHEQL ERNLQLRIEE  360
QGKRLQKMFE DQLKASRSVM EPQELDDVVA FAVGDGHDDA FDDDVQLLTV AGSGYDDAGF  420
SSKIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1019510.0AK101951.1 Oryza sativa Japonica Group cDNA clone:J033075I07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636273.10.0PREDICTED: uncharacterized protein LOC4337318 isoform X2
TrEMBLA0A0E0KWF40.0A0A0E0KWF4_ORYPU; Uncharacterized protein
STRINGLOC_Os04g56990.10.0(Oryza sativa Japonica Group)
STRINGORGLA04G0249600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69333751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.11e-63G2-like family protein